Human bCMO1(Beta-Carotene-15,15′-Monooxygenase 1) ELISA Kit
Beta-Carotene-15,15-Monooxygenase 1 (bCMO1) Antibody |
|||
20-abx171410 | Abbexa |
|
|
beta Carotene-15,15'-Monooxygenase 1 (BCMO1) Antibody |
|||
abx122471-100ug | Abbexa | 100 ug | 469.2 EUR |
Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) Antibody |
|||
20-abx130708 | Abbexa |
|
|
beta Carotene-15,15'-Monooxygenase 1 (BCMO1) Antibody |
|||
abx025732-400ul | Abbexa | 400 ul | 627.6 EUR |
beta Carotene-15,15'-Monooxygenase 1 (BCMO1) Antibody |
|||
abx025732-80l | Abbexa | 80 µl | 343.2 EUR |
beta Carotene-15,15'-Monooxygenase 1 (BCMO1) Antibody |
|||
abx230851-100ug | Abbexa | 100 ug | 577.2 EUR |
Recombinant Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) |
|||
4-RPE246Hu01 | Cloud-Clone |
|
|
Description: Recombinant Human Beta-Carotene-15,15'-Monooxygenase 1 expressed in: E.coli |
|||
Human beta Carotene-15,15'-Monooxygenase 1 (bCMO1) ELISA Kit |
|||
20-abx150797 | Abbexa |
|
|
Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) ELISA Kit |
|||
SEE246Hu-10x96wellstestplate | Cloud-Clone | 10x96-wells test plate | 5677.8 EUR |
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) in tissue homogenates, cell lysates and other biological fluids. |
|||
Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) ELISA Kit |
|||
SEE246Hu-1x48wellstestplate | Cloud-Clone | 1x48-wells test plate | 572.76 EUR |
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) in tissue homogenates, cell lysates and other biological fluids. |
|||
Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) ELISA Kit |
|||
SEE246Hu-1x96wellstestplate | Cloud-Clone | 1x96-wells test plate | 766.8 EUR |
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) in tissue homogenates, cell lysates and other biological fluids. |
|||
Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) ELISA Kit |
|||
SEE246Hu-5x96wellstestplate | Cloud-Clone | 5x96-wells test plate | 3090.6 EUR |
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) in tissue homogenates, cell lysates and other biological fluids. |
|||
Human Beta,beta- carotene 15,15'- monooxygenase, BCMO1 ELISA KIT |
|||
ELI-10937h | Lifescience Market | 96 Tests | 988.8 EUR |
Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) Protein |
|||
20-abx650585 | Abbexa |
|
|
Mouse Beta,beta- carotene 15,15'- monooxygenase, Bcmo1 ELISA KIT |
|||
ELI-11036m | Lifescience Market | 96 Tests | 1038 EUR |
Human beta Carotene-15,15'-Monooxygenase 1 (bCMO1) CLIA Kit |
|||
20-abx494551 | Abbexa |
|
|
ELISA kit for Human bCMO1 (Beta-Carotene-15,15'-Monooxygenase 1) |
|||
ELK4791 | ELK Biotech | 1 plate of 96 wells | 518.4 EUR |
Description: A sandwich ELISA kit for detection of Beta-Carotene-15,15'-Monooxygenase 1 from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids. |
|||
Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) ELISA Kit |
|||
4-SEE246Hu | Cloud-Clone |
|
|
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) in samples from tissue homogenates, cell lysates and other biological fluids with no significant corss-reactivity with analogues from other species. |
|||
Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) Polyclonal Antibody (Human) |
|||
4-PAE246Hu01 | Cloud-Clone |
|
|
Description: A Rabbit polyclonal antibody against Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) |
|||
Human Beta,beta-carotene 15,15'-dioxygenase (BCO1) ELISA Kit |
|||
abx392200-96tests | Abbexa | 96 tests | 1093.2 EUR |
Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) Polyclonal Antibody (Human), APC |
|||
4-PAE246Hu01-APC | Cloud-Clone |
|
|
Description: A Rabbit polyclonal antibody against Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1). This antibody is labeled with APC. |
|||
Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) Polyclonal Antibody (Human), Biotinylated |
|||
4-PAE246Hu01-Biotin | Cloud-Clone |
|
|
Description: A Rabbit polyclonal antibody against Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1). This antibody is labeled with Biotin. |
|||
Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) Polyclonal Antibody (Human), Cy3 |
|||
4-PAE246Hu01-Cy3 | Cloud-Clone |
|
|
Description: A Rabbit polyclonal antibody against Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1). This antibody is labeled with Cy3. |
|||
Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) Polyclonal Antibody (Human), FITC |
|||
4-PAE246Hu01-FITC | Cloud-Clone |
|
|
Description: A Rabbit polyclonal antibody against Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1). This antibody is labeled with FITC. |
|||
Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) Polyclonal Antibody (Human), HRP |
|||
4-PAE246Hu01-HRP | Cloud-Clone |
|
|
Description: A Rabbit polyclonal antibody against Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1). This antibody is labeled with HRP. |
|||
Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) Polyclonal Antibody (Human), PE |
|||
4-PAE246Hu01-PE | Cloud-Clone |
|
|
Description: A Rabbit polyclonal antibody against Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1). This antibody is labeled with PE. |
|||
Rat Beta,beta-Carotene 15,15-Dioxygenase (BCO1) ELISA Kit |
|||
abx391017-96tests | Abbexa | 96 tests | 1093.2 EUR |
Mouse Beta,beta-Carotene 15,15-Dioxygenase (BCO1) ELISA Kit |
|||
abx388677-96tests | Abbexa | 96 tests | 1093.2 EUR |
Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) Polyclonal Antibody (Human), APC-Cy7 |
|||
4-PAE246Hu01-APC-Cy7 | Cloud-Clone |
|
|
Description: A Rabbit polyclonal antibody against Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1). This antibody is labeled with APC-Cy7. |
|||
Beta,beta-Carotene 15,15'-Dioxygenase (BCO1) Antibody |
|||
20-abx310811 | Abbexa |
|
|
Beta,beta-Carotene 15,15'-Dioxygenase (BCO1) Antibody (HRP) |
|||
20-abx310812 | Abbexa |
|
|
Beta,beta-Carotene 15,15'-Dioxygenase (BCO1) Antibody (FITC) |
|||
20-abx310813 | Abbexa |
|
|
Beta,beta-Carotene 15,15'-Dioxygenase (BCO1) Antibody (Biotin) |
|||
20-abx310814 | Abbexa |
|
|
Human beta carotene |
|||
QY-E05643 | Qayee Biotechnology | 96T | 433.2 EUR |
beta-Carotene |
|||
GP8334-10G | Glentham Life Sciences | 10 g | 122.4 EUR |
beta-Carotene |
|||
GP8334-1G | Glentham Life Sciences | 1 g | 57.6 EUR |
beta-Carotene |
|||
GP8334-25G | Glentham Life Sciences | 25 g | 208.8 EUR |
beta-Carotene |
|||
GP8334-5G | Glentham Life Sciences | 5 g | 88.8 EUR |
Beta-Carotene |
|||
TB0299 | ChemNorm | 8XX100mg | 328.8 EUR |
Custom Antibody titration by ELISA up to 2 rabbits and 1 bleed |
|||
ELISA-1 | Alpha Diagnostics | 1 | 242.4 EUR |
Bcmo1/ Rat Bcmo1 ELISA Kit |
|||
ELI-33406r | Lifescience Market | 96 Tests | 1063.2 EUR |
Human Beta,beta-Carotene 9',10'-Oxygenase (BCO2) ELISA Kit |
|||
abx250481-96tests | Abbexa | 96 tests | 801.6 EUR |
Human BCO2(Beta,beta-carotene 9',10'-oxygenase) ELISA Kit |
|||
EH1224 | FN Test | 96T | 681.12 EUR |
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Homo sapiens;Sensitivity: 0.469 ng/ml |
|||
ELISA kit for Human Beta,beta-carotene 9',10'-oxygenase |
|||
EK2713 | SAB | 96 tests | 663.6 EUR |
Description: Enzyme-linked immunosorbent assay kit for quantification of Human Beta,beta-carotene 9',10'-oxygenase in samples from serum, plasma, tissue homogenates and other biological fluids. |
|||
Human Beta,beta- carotene 9',10'- oxygenase, BCO2 ELISA KIT |
|||
ELI-49386h | Lifescience Market | 96 Tests | 988.8 EUR |
Human BCO2/ Beta,beta-carotene 9',10'-oxygenase ELISA Kit |
|||
E0265Hu | Sunlong | 1 Kit | 726 EUR |
Mouse Beta,beta-Carotene 9',10'-Oxygenase (BCO2) ELISA Kit |
|||
abx515122-96tests | Abbexa | 96 tests | 886.8 EUR |
Mouse Bco2/ Beta,beta-carotene 9',10'-oxygenase ELISA Kit |
|||
E0170Mo | Sunlong | 1 Kit | 758.4 EUR |
Mouse Beta,beta- carotene 9',10'- oxygenase, Bco2 ELISA KIT |
|||
ELI-49387m | Lifescience Market | 96 Tests | 1038 EUR |
Human Interleukin-1 beta (IL-1 beta) AssayMax ELISA Kit |
|||
EI2200-1 | AssayPro | 96 Well Plate | 572.4 EUR |
BCMO1 ELISA Kit (Human) (OKCD04382) |
|||
OKCD04382 | Aviva Systems Biology | 96 Wells | 997.2 EUR |
Description: Description of target: Vitamin A metabolism is important for vital processes such as vision, embryonic development, cell differentiation, and membrane and skin protection. The protein encoded by this gene is a key enzyme in beta-carotene metabolism to vitamin A. It catalyzes the oxidative cleavage of beta,beta-carotene into two retinal molecules.;Species reactivity: Human;Application: ;Assay info: Assay Methodology: Quantitative Sandwich ELISA;Sensitivity: 0.49 ng/mL |
|||
Human TGF-beta-1 AssayMax ELISA Kit |
|||
ET3102-1 | AssayPro | 96 Well Plate | 572.4 EUR |
Chicken BCMO1 ELISA KIT |
|||
ELI-25375c | Lifescience Market | 96 Tests | 1113.6 EUR |
Beta,beta-Carotene 9',10'-Oxygenase (BCO2) Antibody |
|||
20-abx003844 | Abbexa |
|
|
Beta,beta-Carotene 9',10'-Oxygenase (BCO2) Antibody |
|||
abx122472-100ug | Abbexa | 100 ug | 469.2 EUR |
Beta,beta-Carotene 9',10'-Oxygenase (BCO2) Antibody |
|||
abx230852-100ug | Abbexa | 100 ug | 577.2 EUR |
Mouse Interleukin-1 beta (IL-1 beta) AssayMax ELISA Kit |
|||
EMI2200-1 | AssayPro | 96 Well Plate | 572.4 EUR |
YWHAB Tyr-3/Trp- 5 Monooxygenase Activation Protein Beta Human Recombinant Protein |
|||
PROTP31946-1 | BosterBio | Regular: 25ug | 380.4 EUR |
Description: YWHAB Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 246 amino acids (1-246) and having a molecular mass of 28kDa. ;YWHAB is purified by proprietary chromatographic techniques. |
|||
β-Carotene |
|||
HY-N0411 | MedChemExpress | 50mg | 129.6 EUR |
alpha-Carotene |
|||
TBZ2607 | ChemNorm | 5mg | Ask for price |
Human Methylsterol monooxygenase 1 (MSMO1) ELISA Kit |
|||
abx385151-96tests | Abbexa | 96 tests | 1093.2 EUR |
Human Methylsterol monooxygenase 1, MSMO1 ELISA KIT |
|||
ELI-23191h | Lifescience Market | 96 Tests | 988.8 EUR |
Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit |
|||
20-abx151570 | Abbexa |
|
|
Human Monooxygenase DBH Like 1 (MOXD1) ELISA Kit |
|||
abx381498-96tests | Abbexa | 96 tests | 1093.2 EUR |
Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit |
|||
DLR-FMO1-Hu-48T | DL Develop | 48T | 620.4 EUR |
Description: A sandwich quantitative ELISA assay kit for detection of Human Flavin Containing Monooxygenase 1 (FMO1) in samples from tissue homogenates or other biological fluids. |
|||
Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit |
|||
DLR-FMO1-Hu-96T | DL Develop | 96T | 807.6 EUR |
Description: A sandwich quantitative ELISA assay kit for detection of Human Flavin Containing Monooxygenase 1 (FMO1) in samples from tissue homogenates or other biological fluids. |
|||
Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit |
|||
SEF458Hu-10x96wellstestplate | Cloud-Clone | 10x96-wells test plate | 5677.8 EUR |
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Flavin Containing Monooxygenase 1 (FMO1) in Tissue homogenates and other biological fluids. |
|||
Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit |
|||
SEF458Hu-1x48wellstestplate | Cloud-Clone | 1x48-wells test plate | 572.76 EUR |
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Flavin Containing Monooxygenase 1 (FMO1) in Tissue homogenates and other biological fluids. |
|||
Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit |
|||
SEF458Hu-1x96wellstestplate | Cloud-Clone | 1x96-wells test plate | 766.8 EUR |
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Flavin Containing Monooxygenase 1 (FMO1) in Tissue homogenates and other biological fluids. |
|||
Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit |
|||
SEF458Hu-5x96wellstestplate | Cloud-Clone | 5x96-wells test plate | 3090.6 EUR |
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Flavin Containing Monooxygenase 1 (FMO1) in Tissue homogenates and other biological fluids. |
|||
Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit |
|||
4-SEF458Hu | Cloud-Clone |
|
|
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Flavin Containing Monooxygenase 1 (FMO1) in samples from Tissue homogenates and other biological fluids. with no significant corss-reactivity with analogues from other species. |
|||
Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit |
|||
RDR-FMO1-Hu-48Tests | Reddot Biotech | 48 Tests | 652.8 EUR |
Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit |
|||
RDR-FMO1-Hu-96Tests | Reddot Biotech | 96 Tests | 907.2 EUR |
Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit |
|||
RD-FMO1-Hu-48Tests | Reddot Biotech | 48 Tests | 625.2 EUR |
Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit |
|||
RD-FMO1-Hu-96Tests | Reddot Biotech | 96 Tests | 867.6 EUR |
BCMO1 siRNA |
|||
20-abx909008 | Abbexa |
|
|
BCMO1 siRNA |
|||
20-abx909009 | Abbexa |
|
|
ExoAb Antibody Kit (CD9, CD63, CD81, Hsp70 antibodies, rabbit anti-human) with goat anti-rabbit HRP secondary antibody |
|||
EXOAB-KIT-1 | SBI | 25 ul each | 752.4 EUR |
mRNAExpress mRNA Synthesis kit (5 reactions) |
|||
MR-KIT-1 | SBI | 5 reactions | 1382.4 EUR |
Human Alkylglycerol Monooxygenase (AGMO)ELISA Kit |
|||
201-12-2419 | SunredBio | 96 tests | 528 EUR |
Description: A quantitative ELISA kit for measuring Human in samples from biological fluids. |
|||
Human Alkylglycerol monooxygenase(TMEM195) ELISA kit |
|||
E01A2009-192T | BlueGene | 192 tests | 1524 EUR |
Description: A sandwich ELISA for quantitative measurement of Human Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
|||
Human Alkylglycerol monooxygenase(TMEM195) ELISA kit |
|||
E01A2009-48 | BlueGene | 1 plate of 48 wells | 624 EUR |
Description: A sandwich ELISA for quantitative measurement of Human Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
|||
Human Alkylglycerol monooxygenase(TMEM195) ELISA kit |
|||
E01A2009-96 | BlueGene | 1 plate of 96 wells | 822 EUR |
Description: A sandwich ELISA for quantitative measurement of Human Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
|||
Human SQLE/ Squalene monooxygenase ELISA Kit |
|||
E2385Hu | Sunlong | 1 Kit | 726 EUR |
Kynurenine 3-monooxygenase ELISA Kit|Human |
|||
EF005180 | Lifescience Market | 96 Tests | 826.8 EUR |
Human Alkylglycerol monooxygenase, AGMO ELISA KIT |
|||
ELI-24195h | Lifescience Market | 96 Tests | 988.8 EUR |
Human Squalene monooxygenase, SQLE ELISA KIT |
|||
ELI-32784h | Lifescience Market | 96 Tests | 988.8 EUR |
Human Alkylglycerol Monooxygenase(AGMO)ELISA Kit |
|||
QY-E01119 | Qayee Biotechnology | 96T | 433.2 EUR |
PinPoint-FC 293T Platform Kit for Targeted Gene Insertion (includes PIN320A-1, PIN200A-1, PIN510A-1 & PIN600A-1) |
|||
PIN320A-KIT | SBI | 1 Kit | 5929.2 EUR |
Human Beta-2-Microglobulin (B2M) AssayMax ELISA Kit |
|||
EM5001-1 | AssayPro | 96 Well Plate | 500.4 EUR |
Rat Methylsterol monooxygenase 1 (MSMO1) ELISA Kit |
|||
abx391608-96tests | Abbexa | 96 tests | 1093.2 EUR |
Mouse Methylsterol monooxygenase 1 (MSMO1) ELISA Kit |
|||
abx389876-96tests | Abbexa | 96 tests | 1093.2 EUR |
Chicken Methylsterol monooxygenase 1, MSMO1 ELISA KIT |
|||
ELI-23404c | Lifescience Market | 96 Tests | 1113.6 EUR |
Mouse Methylsterol monooxygenase 1, Msmo1 ELISA KIT |
|||
ELI-45646m | Lifescience Market | 96 Tests | 1038 EUR |
Porcine Methylsterol monooxygenase 1, MSMO1 ELISA KIT |
|||
ELI-42078p | Lifescience Market | 96 Tests | 1113.6 EUR |
PinPoint-FC Murine iPSC Platform Kit for Targeted Gene Insertion (includes PIN340iPS-1, PIN200A-1, PIN510A-1 & PIN600A-1) |
|||
PIN340iPS-KIT | SBI | 1 Kit | 5929.2 EUR |
Human BCMO1 shRNA Plasmid |
|||
20-abx959976 | Abbexa |
|
|
BCMO1 Recombinant Protein (Human) |
|||
RP036973 | ABM | 100 ug | Ask for price |
BCMO1 Recombinant Protein (Human) |
|||
RP036976 | ABM | 100 ug | Ask for price |
Msmo1 ELISA Kit| Mouse Methylsterol monooxygenase 1 ELISA Kit |
|||
EF015513 | Lifescience Market | 96 Tests | 826.8 EUR |
MSMO1 ELISA Kit| chicken Methylsterol monooxygenase 1 ELISA Kit |
|||
EF012392 | Lifescience Market | 96 Tests | 826.8 EUR |
Msmo1 ELISA Kit| Rat Methylsterol monooxygenase 1 ELISA Kit |
|||
EF018966 | Lifescience Market | 96 Tests | 826.8 EUR |
ELISA kit for Human FMO1 (Flavin Containing Monooxygenase 1) |
|||
ELK4594 | ELK Biotech | 1 plate of 96 wells | 518.4 EUR |
Description: A sandwich ELISA kit for detection of Flavin Containing Monooxygenase 1 from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids. |
|||
Human DBH- like monooxygenase protein 1, MOXD1 ELISA KIT |
|||
ELI-43781h | Lifescience Market | 96 Tests | 988.8 EUR |
Tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein Beta (YWHAB) Antibody |
|||
abx332554-100ul | Abbexa | 100 ul | 510 EUR |
Tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein Beta (YWHAB) Antibody |
|||
20-abx329250 | Abbexa |
|
|
Tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein Beta (YWHAB) Antibody |
|||
20-abx241015 | Abbexa |
|
|
Tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein Beta (YWHAB) Antibody |
|||
20-abx241094 | Abbexa |
|
|
Tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein Beta (YWHAB) Antibody |
|||
20-abx214774 | Abbexa |
|
|
Tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein Beta (YWHAB) Antibody |
|||
20-abx214826 | Abbexa |
|
|
Rat Kynurenine 3-monooxygenase(KMO) ELISA kit |
|||
1-CSB-EL012475RA | Cusabio |
|
|
Description: Quantitativesandwich ELISA kit for measuring Rat Kynurenine 3-monooxygenase(KMO) in samples from serum, plasma, tissue homogenates, cell lysates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits. |
|||
Amyloid Beta-Peptide (1-40) (human) |
|||
A1124-1 | ApexBio | 1 mg | 226.8 EUR |
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein. |
|||
Recombinant Human Heregulin Beta -1 Protein |
|||
PROTQ02297-1 | BosterBio | 50ug | 380.4 EUR |
Description: Neuregulin/Heregulin is a family of structurally related polypeptide growth factors derived from alternatively spliced genes (NRG1, NRG2, NRG3 and NRG4). To date, there are over 14 soluble and transmembrane proteins derived from the NRG1 gene. Proteolytic processing of the extracellular domain of the transmembrane NRG1 isoforms release soluble growth factors. HRG1-β1 contains an Ig domain and an EGF-like domain that is necessary for direct binding to receptor tyrosine kinases erb3 and erb4. This binding induces erb3 and erb4 heterodimerization with erb2, stimulating intrinsic kinase activity, which leads to tyrosine phosphorylation. Although HRG1-β1 biological effects is still unclear, it has been found to promote motility and invasiveness of breast cancer cells which may also involve up-regulation of expression and function of the autocrine motility-promoting factor (AMF). Recombinant human Heregulin-β1 (HRG1-β1) is a 7.5 kDa polypeptide consisting of only the EGF domain of Heregulin-β1 (65 amino acid residues). |
|||
Human Genomic DNA |
|||
X11000 | EpiGentek |
|
|
BCMO1 sgRNA CRISPR Lentivector (Human) (Target 1) |
|||
K0177302 | ABM | 1.0 ug DNA | 184.8 EUR |
Human Brain Genomic DNA |
|||
X11001 | EpiGentek |
|
|
Human bCMO1(Beta-Carotene-15,15′-Monooxygenase 1) ELISA Kit