Skip to content
unicoupi

UNICO Microscopes and Spectrophotometers

Anatomical coupes

Menu
  • Home
  • DNA
  • anti-Human
  • Mouse
  • PROTEINS
  • ELISA KITS
Menu

Human bCMO1(Beta-Carotene-15,15′-Monooxygenase 1) ELISA Kit

Human bCMO1(Beta-Carotene-15,15′-Monooxygenase 1) ELISA Kit

Beta-Carotene-15,15-Monooxygenase 1 (bCMO1) Antibody

20-abx171410 Abbexa
  • 1028.40 EUR
  • 526.80 EUR
  • 1 mg
  • 200 ug

beta Carotene-15,15'-Monooxygenase 1 (BCMO1) Antibody

abx122471-100ug Abbexa 100 ug 469.2 EUR

Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) Antibody

20-abx130708 Abbexa
  • 376.80 EUR
  • 159.60 EUR
  • 978.00 EUR
  • 510.00 EUR
  • 326.40 EUR
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug

beta Carotene-15,15'-Monooxygenase 1 (BCMO1) Antibody

abx025732-400ul Abbexa 400 ul 627.6 EUR

beta Carotene-15,15'-Monooxygenase 1 (BCMO1) Antibody

abx025732-80l Abbexa 80 µl 343.2 EUR

beta Carotene-15,15'-Monooxygenase 1 (BCMO1) Antibody

abx230851-100ug Abbexa 100 ug 577.2 EUR

Recombinant Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1)

4-RPE246Hu01 Cloud-Clone
  • 582.34 EUR
  • 279.60 EUR
  • 1853.76 EUR
  • 697.92 EUR
  • 1275.84 EUR
  • 465.60 EUR
  • 4454.40 EUR
  • 100 ug
  • 10ug
  • 1 mg
  • 200 ug
  • 500 ug
  • 50ug
  • 5 mg
Description: Recombinant Human Beta-Carotene-15,15'-Monooxygenase 1 expressed in: E.coli

Human beta Carotene-15,15'-Monooxygenase 1 (bCMO1) ELISA Kit

20-abx150797 Abbexa
  • 8853.60 EUR
  • 4719.60 EUR
  • 1093.20 EUR
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests

Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) ELISA Kit

SEE246Hu-10x96wellstestplate Cloud-Clone 10x96-wells test plate 5677.8 EUR
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) in tissue homogenates, cell lysates and other biological fluids.

Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) ELISA Kit

SEE246Hu-1x48wellstestplate Cloud-Clone 1x48-wells test plate 572.76 EUR
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) in tissue homogenates, cell lysates and other biological fluids.

Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) ELISA Kit

SEE246Hu-1x96wellstestplate Cloud-Clone 1x96-wells test plate 766.8 EUR
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) in tissue homogenates, cell lysates and other biological fluids.

Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) ELISA Kit

SEE246Hu-5x96wellstestplate Cloud-Clone 5x96-wells test plate 3090.6 EUR
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) in tissue homogenates, cell lysates and other biological fluids.

Human Beta,beta- carotene 15,15'- monooxygenase, BCMO1 ELISA KIT

ELI-10937h Lifescience Market 96 Tests 988.8 EUR

Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) Protein

20-abx650585 Abbexa
  • 811.20 EUR
  • 343.20 EUR
  • 2498.40 EUR
  • 961.20 EUR
  • 577.20 EUR
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug

Mouse Beta,beta- carotene 15,15'- monooxygenase, Bcmo1 ELISA KIT

ELI-11036m Lifescience Market 96 Tests 1038 EUR

Human beta Carotene-15,15'-Monooxygenase 1 (bCMO1) CLIA Kit

20-abx494551 Abbexa
  • 9567.60 EUR
  • 5095.20 EUR
  • 1177.20 EUR
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests

ELISA kit for Human bCMO1 (Beta-Carotene-15,15'-Monooxygenase 1)

ELK4791 ELK Biotech 1 plate of 96 wells 518.4 EUR
Description: A sandwich ELISA kit for detection of Beta-Carotene-15,15'-Monooxygenase 1 from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids.

Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) ELISA Kit

4-SEE246Hu Cloud-Clone
  • 5738.40 EUR
  • 3031.20 EUR
  • 768.00 EUR
  • 10 plates of 96 wells
  • 5 plates of 96 wells
  • 1 plate of 96 wells
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) in samples from tissue homogenates, cell lysates and other biological fluids with no significant corss-reactivity with analogues from other species.

Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) Polyclonal Antibody (Human)

4-PAE246Hu01 Cloud-Clone
  • 296.40 EUR
  • 3012.00 EUR
  • 750.00 EUR
  • 372.00 EUR
  • 256.80 EUR
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Rabbit polyclonal antibody against Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1)

Human Beta,beta-carotene 15,15'-dioxygenase (BCO1) ELISA Kit

abx392200-96tests Abbexa 96 tests 1093.2 EUR

Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) Polyclonal Antibody (Human), APC

4-PAE246Hu01-APC Cloud-Clone
  • 414.00 EUR
  • 3930.00 EUR
  • 1094.40 EUR
  • 528.00 EUR
  • 262.80 EUR
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Rabbit polyclonal antibody against Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1). This antibody is labeled with APC.

Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) Polyclonal Antibody (Human), Biotinylated

4-PAE246Hu01-Biotin Cloud-Clone
  • 373.20 EUR
  • 2952.00 EUR
  • 872.40 EUR
  • 457.20 EUR
  • 262.80 EUR
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Rabbit polyclonal antibody against Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1). This antibody is labeled with Biotin.

Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) Polyclonal Antibody (Human), Cy3

4-PAE246Hu01-Cy3 Cloud-Clone
  • 502.80 EUR
  • 5190.00 EUR
  • 1410.00 EUR
  • 654.00 EUR
  • 301.20 EUR
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Rabbit polyclonal antibody against Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1). This antibody is labeled with Cy3.

Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) Polyclonal Antibody (Human), FITC

4-PAE246Hu01-FITC Cloud-Clone
  • 355.20 EUR
  • 3168.00 EUR
  • 900.00 EUR
  • 446.40 EUR
  • 234.00 EUR
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Rabbit polyclonal antibody against Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1). This antibody is labeled with FITC.

Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) Polyclonal Antibody (Human), HRP

4-PAE246Hu01-HRP Cloud-Clone
  • 379.20 EUR
  • 3426.00 EUR
  • 968.40 EUR
  • 477.60 EUR
  • 247.20 EUR
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Rabbit polyclonal antibody against Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1). This antibody is labeled with HRP.

Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) Polyclonal Antibody (Human), PE

4-PAE246Hu01-PE Cloud-Clone
  • 355.20 EUR
  • 3168.00 EUR
  • 900.00 EUR
  • 446.40 EUR
  • 234.00 EUR
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Rabbit polyclonal antibody against Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1). This antibody is labeled with PE.

Rat Beta,beta-Carotene 15,15-Dioxygenase (BCO1) ELISA Kit

abx391017-96tests Abbexa 96 tests 1093.2 EUR

Mouse Beta,beta-Carotene 15,15-Dioxygenase (BCO1) ELISA Kit

abx388677-96tests Abbexa 96 tests 1093.2 EUR

Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) Polyclonal Antibody (Human), APC-Cy7

4-PAE246Hu01-APC-Cy7 Cloud-Clone
  • 685.20 EUR
  • 7716.00 EUR
  • 2046.00 EUR
  • 912.00 EUR
  • 382.80 EUR
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Rabbit polyclonal antibody against Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1). This antibody is labeled with APC-Cy7.

Beta,beta-Carotene 15,15'-Dioxygenase (BCO1) Antibody

20-abx310811 Abbexa
  • 493.20 EUR
  • 2214.00 EUR
  • 718.80 EUR
  • 218.40 EUR
  • 360.00 EUR
  • 100 ug
  • 1 mg
  • 200 ug
  • 20 ug
  • 50 ug

Beta,beta-Carotene 15,15'-Dioxygenase (BCO1) Antibody (HRP)

20-abx310812 Abbexa
  • 493.20 EUR
  • 2214.00 EUR
  • 718.80 EUR
  • 218.40 EUR
  • 360.00 EUR
  • 100 ug
  • 1 mg
  • 200 ug
  • 20 ug
  • 50 ug

Beta,beta-Carotene 15,15'-Dioxygenase (BCO1) Antibody (FITC)

20-abx310813 Abbexa
  • 493.20 EUR
  • 2214.00 EUR
  • 718.80 EUR
  • 218.40 EUR
  • 360.00 EUR
  • 100 ug
  • 1 mg
  • 200 ug
  • 20 ug
  • 50 ug

Beta,beta-Carotene 15,15'-Dioxygenase (BCO1) Antibody (Biotin)

20-abx310814 Abbexa
  • 493.20 EUR
  • 2214.00 EUR
  • 718.80 EUR
  • 218.40 EUR
  • 360.00 EUR
  • 100 ug
  • 1 mg
  • 200 ug
  • 20 ug
  • 50 ug

Human beta carotene

QY-E05643 Qayee Biotechnology 96T 433.2 EUR

beta-Carotene

GP8334-10G Glentham Life Sciences 10 g 122.4 EUR

beta-Carotene

GP8334-1G Glentham Life Sciences 1 g 57.6 EUR

beta-Carotene

GP8334-25G Glentham Life Sciences 25 g 208.8 EUR

beta-Carotene

GP8334-5G Glentham Life Sciences 5 g 88.8 EUR

Beta-Carotene

TB0299 ChemNorm 8XX100mg 328.8 EUR

Custom Antibody titration by ELISA up to 2 rabbits and 1 bleed

ELISA-1 Alpha Diagnostics 1 242.4 EUR

Bcmo1/ Rat Bcmo1 ELISA Kit

ELI-33406r Lifescience Market 96 Tests 1063.2 EUR

Human Beta,beta-Carotene 9',10'-Oxygenase (BCO2) ELISA Kit

abx250481-96tests Abbexa 96 tests 801.6 EUR

Human BCO2(Beta,beta-carotene 9',10'-oxygenase) ELISA Kit

EH1224 FN Test 96T 681.12 EUR
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Homo sapiens;Sensitivity: 0.469 ng/ml

ELISA kit for Human Beta,beta-carotene 9',10'-oxygenase

EK2713 SAB 96 tests 663.6 EUR
Description: Enzyme-linked immunosorbent assay kit for quantification of Human Beta,beta-carotene 9',10'-oxygenase in samples from serum, plasma, tissue homogenates and other biological fluids.

Human Beta,beta- carotene 9',10'- oxygenase, BCO2 ELISA KIT

ELI-49386h Lifescience Market 96 Tests 988.8 EUR

Human BCO2/ Beta,beta-carotene 9',10'-oxygenase ELISA Kit

E0265Hu Sunlong 1 Kit 726 EUR

Mouse Beta,beta-Carotene 9',10'-Oxygenase (BCO2) ELISA Kit

abx515122-96tests Abbexa 96 tests 886.8 EUR

Mouse Bco2/ Beta,beta-carotene 9',10'-oxygenase ELISA Kit

E0170Mo Sunlong 1 Kit 758.4 EUR

Mouse Beta,beta- carotene 9',10'- oxygenase, Bco2 ELISA KIT

ELI-49387m Lifescience Market 96 Tests 1038 EUR

Human Interleukin-1 beta (IL-1 beta) AssayMax ELISA Kit

EI2200-1 AssayPro 96 Well Plate 572.4 EUR

BCMO1 ELISA Kit (Human) (OKCD04382)

OKCD04382 Aviva Systems Biology 96 Wells 997.2 EUR
Description: Description of target: Vitamin A metabolism is important for vital processes such as vision, embryonic development, cell differentiation, and membrane and skin protection. The protein encoded by this gene is a key enzyme in beta-carotene metabolism to vitamin A. It catalyzes the oxidative cleavage of beta,beta-carotene into two retinal molecules.;Species reactivity: Human;Application: ;Assay info: Assay Methodology: Quantitative Sandwich ELISA;Sensitivity: 0.49 ng/mL

Human TGF-beta-1 AssayMax ELISA Kit

ET3102-1 AssayPro 96 Well Plate 572.4 EUR

Chicken BCMO1 ELISA KIT

ELI-25375c Lifescience Market 96 Tests 1113.6 EUR

Beta,beta-Carotene 9',10'-Oxygenase (BCO2) Antibody

20-abx003844 Abbexa
  • 493.20 EUR
  • 710.40 EUR
  • 218.40 EUR
  • 376.80 EUR
  • 100 ul
  • 200 ul
  • 20 ul
  • 50 ul

Beta,beta-Carotene 9',10'-Oxygenase (BCO2) Antibody

abx122472-100ug Abbexa 100 ug 469.2 EUR

Beta,beta-Carotene 9',10'-Oxygenase (BCO2) Antibody

abx230852-100ug Abbexa 100 ug 577.2 EUR

Mouse Interleukin-1 beta (IL-1 beta) AssayMax ELISA Kit

EMI2200-1 AssayPro 96 Well Plate 572.4 EUR

YWHAB Tyr-3/Trp- 5 Monooxygenase Activation Protein Beta Human Recombinant Protein

PROTP31946-1 BosterBio Regular: 25ug 380.4 EUR
Description: YWHAB Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 246 amino acids (1-246) and having a molecular mass of 28kDa. ;YWHAB is purified by proprietary chromatographic techniques.

β-Carotene

HY-N0411 MedChemExpress 50mg 129.6 EUR

alpha-Carotene

TBZ2607 ChemNorm 5mg Ask for price

Human Methylsterol monooxygenase 1 (MSMO1) ELISA Kit

abx385151-96tests Abbexa 96 tests 1093.2 EUR

Human Methylsterol monooxygenase 1, MSMO1 ELISA KIT

ELI-23191h Lifescience Market 96 Tests 988.8 EUR

Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit

20-abx151570 Abbexa
  • 8853.60 EUR
  • 4719.60 EUR
  • 1093.20 EUR
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests

Human Monooxygenase DBH Like 1 (MOXD1) ELISA Kit

abx381498-96tests Abbexa 96 tests 1093.2 EUR

Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit

DLR-FMO1-Hu-48T DL Develop 48T 620.4 EUR
Description: A sandwich quantitative ELISA assay kit for detection of Human Flavin Containing Monooxygenase 1 (FMO1) in samples from tissue homogenates or other biological fluids.

Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit

DLR-FMO1-Hu-96T DL Develop 96T 807.6 EUR
Description: A sandwich quantitative ELISA assay kit for detection of Human Flavin Containing Monooxygenase 1 (FMO1) in samples from tissue homogenates or other biological fluids.

Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit

SEF458Hu-10x96wellstestplate Cloud-Clone 10x96-wells test plate 5677.8 EUR
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Flavin Containing Monooxygenase 1 (FMO1) in Tissue homogenates and other biological fluids.

Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit

SEF458Hu-1x48wellstestplate Cloud-Clone 1x48-wells test plate 572.76 EUR
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Flavin Containing Monooxygenase 1 (FMO1) in Tissue homogenates and other biological fluids.

Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit

SEF458Hu-1x96wellstestplate Cloud-Clone 1x96-wells test plate 766.8 EUR
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Flavin Containing Monooxygenase 1 (FMO1) in Tissue homogenates and other biological fluids.

Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit

SEF458Hu-5x96wellstestplate Cloud-Clone 5x96-wells test plate 3090.6 EUR
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Flavin Containing Monooxygenase 1 (FMO1) in Tissue homogenates and other biological fluids.

Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit

4-SEF458Hu Cloud-Clone
  • 5738.40 EUR
  • 3031.20 EUR
  • 768.00 EUR
  • 10 plates of 96 wells
  • 5 plates of 96 wells
  • 1 plate of 96 wells
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Flavin Containing Monooxygenase 1 (FMO1) in samples from Tissue homogenates and other biological fluids. with no significant corss-reactivity with analogues from other species.

Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit

RDR-FMO1-Hu-48Tests Reddot Biotech 48 Tests 652.8 EUR

Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit

RDR-FMO1-Hu-96Tests Reddot Biotech 96 Tests 907.2 EUR

Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit

RD-FMO1-Hu-48Tests Reddot Biotech 48 Tests 625.2 EUR

Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit

RD-FMO1-Hu-96Tests Reddot Biotech 96 Tests 867.6 EUR

BCMO1 siRNA

20-abx909008 Abbexa
  • 661.20 EUR
  • 878.40 EUR
  • 15 nmol
  • 30 nmol

BCMO1 siRNA

20-abx909009 Abbexa
  • 661.20 EUR
  • 878.40 EUR
  • 15 nmol
  • 30 nmol

ExoAb Antibody Kit (CD9, CD63, CD81, Hsp70 antibodies, rabbit anti-human) with goat anti-rabbit HRP secondary antibody

EXOAB-KIT-1 SBI 25 ul each 752.4 EUR

mRNAExpress mRNA Synthesis kit (5 reactions)

MR-KIT-1 SBI 5 reactions 1382.4 EUR

Human Alkylglycerol Monooxygenase (AGMO)ELISA Kit

201-12-2419 SunredBio 96 tests 528 EUR
Description: A quantitative ELISA kit for measuring Human in samples from biological fluids.

Human Alkylglycerol monooxygenase(TMEM195) ELISA kit

E01A2009-192T BlueGene 192 tests 1524 EUR
Description: A sandwich ELISA for quantitative measurement of Human Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Human Alkylglycerol monooxygenase(TMEM195) ELISA kit

E01A2009-48 BlueGene 1 plate of 48 wells 624 EUR
Description: A sandwich ELISA for quantitative measurement of Human Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Human Alkylglycerol monooxygenase(TMEM195) ELISA kit

E01A2009-96 BlueGene 1 plate of 96 wells 822 EUR
Description: A sandwich ELISA for quantitative measurement of Human Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Human SQLE/ Squalene monooxygenase ELISA Kit

E2385Hu Sunlong 1 Kit 726 EUR

Kynurenine 3-monooxygenase ELISA Kit|Human

EF005180 Lifescience Market 96 Tests 826.8 EUR

Human Alkylglycerol monooxygenase, AGMO ELISA KIT

ELI-24195h Lifescience Market 96 Tests 988.8 EUR

Human Squalene monooxygenase, SQLE ELISA KIT

ELI-32784h Lifescience Market 96 Tests 988.8 EUR

Human Alkylglycerol Monooxygenase(AGMO)ELISA Kit

QY-E01119 Qayee Biotechnology 96T 433.2 EUR

PinPoint-FC 293T Platform Kit for Targeted Gene Insertion (includes PIN320A-1, PIN200A-1, PIN510A-1 & PIN600A-1)

PIN320A-KIT SBI 1 Kit 5929.2 EUR

Human Beta-2-Microglobulin (B2M) AssayMax ELISA Kit

EM5001-1 AssayPro 96 Well Plate 500.4 EUR

Rat Methylsterol monooxygenase 1 (MSMO1) ELISA Kit

abx391608-96tests Abbexa 96 tests 1093.2 EUR

Mouse Methylsterol monooxygenase 1 (MSMO1) ELISA Kit

abx389876-96tests Abbexa 96 tests 1093.2 EUR

Chicken Methylsterol monooxygenase 1, MSMO1 ELISA KIT

ELI-23404c Lifescience Market 96 Tests 1113.6 EUR

Mouse Methylsterol monooxygenase 1, Msmo1 ELISA KIT

ELI-45646m Lifescience Market 96 Tests 1038 EUR

Porcine Methylsterol monooxygenase 1, MSMO1 ELISA KIT

ELI-42078p Lifescience Market 96 Tests 1113.6 EUR

PinPoint-FC Murine iPSC Platform Kit for Targeted Gene Insertion (includes PIN340iPS-1, PIN200A-1, PIN510A-1 & PIN600A-1)

PIN340iPS-KIT SBI 1 Kit 5929.2 EUR

Human BCMO1 shRNA Plasmid

20-abx959976 Abbexa
  • 961.20 EUR
  • 1345.20 EUR
  • 150 µg
  • 300 µg

BCMO1 Recombinant Protein (Human)

RP036973 ABM 100 ug Ask for price

BCMO1 Recombinant Protein (Human)

RP036976 ABM 100 ug Ask for price

Msmo1 ELISA Kit| Mouse Methylsterol monooxygenase 1 ELISA Kit

EF015513 Lifescience Market 96 Tests 826.8 EUR

MSMO1 ELISA Kit| chicken Methylsterol monooxygenase 1 ELISA Kit

EF012392 Lifescience Market 96 Tests 826.8 EUR

Msmo1 ELISA Kit| Rat Methylsterol monooxygenase 1 ELISA Kit

EF018966 Lifescience Market 96 Tests 826.8 EUR

ELISA kit for Human FMO1 (Flavin Containing Monooxygenase 1)

ELK4594 ELK Biotech 1 plate of 96 wells 518.4 EUR
Description: A sandwich ELISA kit for detection of Flavin Containing Monooxygenase 1 from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids.

Human DBH- like monooxygenase protein 1, MOXD1 ELISA KIT

ELI-43781h Lifescience Market 96 Tests 988.8 EUR

Tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein Beta (YWHAB) Antibody

abx332554-100ul Abbexa 100 ul 510 EUR

Tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein Beta (YWHAB) Antibody

20-abx329250 Abbexa
  • 376.80 EUR
  • 292.80 EUR
  • 100 ug
  • 50 ug

Tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein Beta (YWHAB) Antibody

20-abx241015 Abbexa
  • 493.20 EUR
  • 360.00 EUR
  • 100 ul
  • 50 ul

Tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein Beta (YWHAB) Antibody

20-abx241094 Abbexa
  • 493.20 EUR
  • 360.00 EUR
  • 100 ul
  • 50 ul

Tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein Beta (YWHAB) Antibody

20-abx214774 Abbexa
  • 493.20 EUR
  • 360.00 EUR
  • 100 ul
  • 50 ul

Tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein Beta (YWHAB) Antibody

20-abx214826 Abbexa
  • 493.20 EUR
  • 360.00 EUR
  • 100 ul
  • 50 ul

Rat Kynurenine 3-monooxygenase(KMO) ELISA kit

1-CSB-EL012475RA Cusabio
  • 964.80 EUR
  • 6118.80 EUR
  • 3244.80 EUR
  • 1 plate of 96 wells
  • 10 plates of 96 wells each
  • 5 plates of 96 wells each
Description: Quantitativesandwich ELISA kit for measuring Rat Kynurenine 3-monooxygenase(KMO) in samples from serum, plasma, tissue homogenates, cell lysates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.

Amyloid Beta-Peptide (1-40) (human)

A1124-1 ApexBio 1 mg 226.8 EUR
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein.

Recombinant Human Heregulin Beta -1 Protein

PROTQ02297-1 BosterBio 50ug 380.4 EUR
Description: Neuregulin/Heregulin is a family of structurally related polypeptide growth factors derived from alternatively spliced genes (NRG1, NRG2, NRG3 and NRG4). To date, there are over 14 soluble and transmembrane proteins derived from the NRG1 gene. Proteolytic processing of the extracellular domain of the transmembrane NRG1 isoforms release soluble growth factors. HRG1-β1 contains an Ig domain and an EGF-like domain that is necessary for direct binding to receptor tyrosine kinases erb3 and erb4. This binding induces erb3 and erb4 heterodimerization with erb2, stimulating intrinsic kinase activity, which leads to tyrosine phosphorylation. Although HRG1-β1 biological effects is still unclear, it has been found to promote motility and invasiveness of breast cancer cells which may also involve up-regulation of expression and function of the autocrine motility-promoting factor (AMF). Recombinant human Heregulin-β1 (HRG1-β1) is a 7.5 kDa polypeptide consisting of only the EGF domain of Heregulin-β1 (65 amino acid residues).

Human Genomic DNA 

X11000 EpiGentek
  • Ask for price
  • 235.40 EUR
  • 0.2 ml
  • 0.2 ml

BCMO1 sgRNA CRISPR Lentivector (Human) (Target 1)

K0177302 ABM 1.0 ug DNA 184.8 EUR

Human Brain Genomic DNA  

X11001 EpiGentek
  • Ask for price
  • 77.00 EUR
  • 10 µg
  • 10 ul
×

Human bCMO1(Beta-Carotene-15,15′-Monooxygenase 1) ELISA Kit

Dylan Burnette Follow

Cell biologist studying how a heart grows and dies. Cell Division; Cell Enlargement; Cell Death. Artist and fashion designer. Associate Professor. (he/him)

MAG2ART
mag2art Dylan Burnette @mag2art ·
6h

Two cells photographed through a microscope. DNA in the nucleus, the endoplasmic reticulum, and actin filaments are shown.
#CellBiology #sciart

Reply on Twitter 1621478614956142592 Retweet on Twitter 1621478614956142592 1 Like on Twitter 1621478614956142592 30 Twitter 1621478614956142592
mag2art Dylan Burnette @mag2art ·
2 Feb

Three cells photographed through a microscope. DNA in the nuclei (blue), mitochondria (green) and actin filaments (red) are shown. #CellBiology

Reply on Twitter 1621191643205439488 Retweet on Twitter 1621191643205439488 36 Like on Twitter 1621191643205439488 309 Twitter 1621191643205439488
mag2art Dylan Burnette @mag2art ·
2 Feb

A cell going through cell division videoed through a microscope. DNA (red), Golgi (green) and actin (blue) are shown. XZ view (top) and XY view (bottom) #CellBiology

Reply on Twitter 1620981124963962881 Retweet on Twitter 1620981124963962881 5 Like on Twitter 1620981124963962881 36 Twitter 1620981124963962881
mag2art Dylan Burnette @mag2art ·
1 Feb

The dance sequence at the end of Disney’s Descendants 2 is epic.

Reply on Twitter 1620617563410690049 Retweet on Twitter 1620617563410690049 Like on Twitter 1620617563410690049 5 Twitter 1620617563410690049
Load More

Recent Posts

  • Compare antibodies lab reagents for research
  • Compare Pcr lab reagents for research
  • Compare Appoptosis lab reagents for research
  • TEST Lab Reagents for Research
  • rec. Lab Reagents for Research
  • anti-Human
  • beads
  • Biotin
  • Bird
  • Camel
  • Direct Observation of Defect Range and Evolution in Ion-Irradiated Single Crystalline Ni and Ni Binary Alloys.
  • DNA
  • ELISA KITS
  • Fabrication of NiO/NiCo2O4 Mixtures as Excellent Microwave Absorbers.
  • Goat
  • Hamster
  • Horse
  • Mouse
  • PCR
  • peptide
  • Physical and electrochemical area determination of electrodeposited Ni, Co, and NiCo thin films.
  • PROTEINS
  • Pseudocapacitance of Mesoporous Spinel-Type MCo2O4 (M = Co, Zn, and Ni) Rods Fabricated by a Facile Solvothermal Route.
  • Rat
  • Reduced Graphene Oxide-Conjugated Urchin-Like NiCo2O4 Nanostructures for Individual Detection of o-Nitro and p-Amino Phenol.
  • RNA
  • Sheep
  • Spoligotyping
  • Standard
  • strip
  • Target
  • Yeast
  • anti-Human
  • beads
  • Biotin
  • Bird
  • Camel
  • Direct Observation of Defect Range and Evolution in Ion-Irradiated Single Crystalline Ni and Ni Binary Alloys.
  • DNA
  • ELISA KITS
  • Fabrication of NiO/NiCo2O4 Mixtures as Excellent Microwave Absorbers.
  • Goat
  • Hamster
  • Horse
  • Mouse
  • PCR
  • peptide
  • Physical and electrochemical area determination of electrodeposited Ni, Co, and NiCo thin films.
  • PROTEINS
  • Pseudocapacitance of Mesoporous Spinel-Type MCo2O4 (M = Co, Zn, and Ni) Rods Fabricated by a Facile Solvothermal Route.
  • Rat
  • Reduced Graphene Oxide-Conjugated Urchin-Like NiCo2O4 Nanostructures for Individual Detection of o-Nitro and p-Amino Phenol.
  • RNA
  • Sheep
  • Spoligotyping
  • Standard
  • strip
  • Target
  • Yeast
  • Compare antibodies lab reagents for research
  • Compare Pcr lab reagents for research
  • Compare Appoptosis lab reagents for research
  • TEST Lab Reagents for Research
  • rec. Lab Reagents for Research
© 2023 UNICO Microscopes and Spectrophotometers | Powered by Superbs Personal Blog theme