Human bCMO1(Beta-Carotene-15,15′-Monooxygenase 1) ELISA Kit

Human bCMO1(Beta-Carotene-15,15′-Monooxygenase 1) ELISA Kit

Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) ELISA Kit

RD-bCMO1-Hu-96Tests 96 Tests
EUR 723

Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) ELISA Kit

RDR-bCMO1-Hu-48Tests 48 Tests
EUR 544

Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) ELISA Kit

RDR-bCMO1-Hu-96Tests 96 Tests
EUR 756

Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) Antibody

  • EUR 314.00
  • EUR 133.00
  • EUR 815.00
  • EUR 425.00
  • EUR 272.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-7 working days.

beta Carotene-15,15'-Monooxygenase 1 (BCMO1) Antibody

abx122471-100ug 100 ug
EUR 391
  • Shipped within 5-10 working days.

beta Carotene-15,15'-Monooxygenase 1 (BCMO1) Antibody

abx025732-400ul 400 ul
EUR 523
  • Shipped within 5-10 working days.

beta Carotene-15,15'-Monooxygenase 1 (BCMO1) Antibody

abx025732-80l 80 µl
EUR 286
  • Shipped within 5-10 working days.

beta Carotene-15,15'-Monooxygenase 1 (BCMO1) Antibody

abx230851-100ug 100 ug
EUR 481
  • Shipped within 5-12 working days.

Beta-Carotene-15,15-Monooxygenase 1 (bCMO1) Antibody

  • EUR 857.00
  • EUR 439.00
  • 1 mg
  • 200 ug
  • Please enquire.

Recombinant Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1)

  • EUR 485.28
  • EUR 233.00
  • EUR 1544.80
  • EUR 581.60
  • EUR 1063.20
  • EUR 388.00
  • EUR 3712.00
  • 100 ug
  • 10ug
  • 1 mg
  • 200 ug
  • 500 ug
  • 50ug
  • 5 mg
  • Uniprot ID: Q9HAY6
  • Buffer composition: 20mM Tris, 150mM NaCl, pH8.0, containing 1mM EDTA, 1mM DTT, 0.01% SKL, 5% Trehalose and Proclin300.
  • Form: Freeze-dried powder
  • Predicted Molecular Mass (KD): 26.6kDa
  • Isoelectric Point: 8.9
Description: Recombinant Human Beta-Carotene-15,15'-Monooxygenase 1 expressed in: E.coli

Human beta Carotene-15,15'-Monooxygenase 1 (bCMO1) ELISA Kit

  • EUR 7378.00
  • EUR 3933.00
  • EUR 911.00
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests
  • Shipped within 5-7 working days.

Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) ELISA Kit

SEE246Hu-10x96wellstestplate 10x96-wells test plate
EUR 4731.5
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inte
  • Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) in tissue homogenates, cell lysates and other biological fluids.

Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) ELISA Kit

SEE246Hu-1x48wellstestplate 1x48-wells test plate
EUR 477.3
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inte
  • Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) in tissue homogenates, cell lysates and other biological fluids.

Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) ELISA Kit

SEE246Hu-1x96wellstestplate 1x96-wells test plate
EUR 639
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inte
  • Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) in tissue homogenates, cell lysates and other biological fluids.

Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) ELISA Kit

SEE246Hu-5x96wellstestplate 5x96-wells test plate
EUR 2575.5
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inte
  • Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) in tissue homogenates, cell lysates and other biological fluids.

Human Beta,beta- carotene 15,15'- monooxygenase, BCMO1 ELISA KIT

ELI-10937h 96 Tests
EUR 824

Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) Protein

  • EUR 676.00
  • EUR 286.00
  • EUR 2082.00
  • EUR 801.00
  • EUR 481.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-7 working days.

Mouse Beta,beta- carotene 15,15'- monooxygenase, Bcmo1 ELISA KIT

ELI-11036m 96 Tests
EUR 865

Human beta Carotene-15,15'-Monooxygenase 1 (bCMO1) CLIA Kit

  • EUR 7973.00
  • EUR 4246.00
  • EUR 981.00
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests
  • Please enquire.

ELISA kit for Human bCMO1 (Beta-Carotene-15,15'-Monooxygenase 1)

ELK4791 1 plate of 96 wells
EUR 432
  • The microtiter plate provided in this kit has been pre-coated with an antibody specific to Beta-Carotene-15,15'-Monooxygenase 1 (?CMO1). Standards or samples are then added to the appropriate microtiter plate wells with a biotin-conjugated antibody s
  • Show more
Description: A sandwich ELISA kit for detection of Beta-Carotene-15,15'-Monooxygenase 1 from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids.

Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) ELISA Kit

  • EUR 4782.00
  • EUR 2526.00
  • EUR 640.00
  • 10 plates of 96 wells
  • 5 plates of 96 wells
  • 1 plate of 96 wells
  • Known also as Beta-Carotene-15, 15'-Monooxygenase 1 elisa. Alternative names of the recognized antigen: BCO1
  • BCDO
  • BCDO1
  • BCMO
  • Beta-carotene dioxygenase 1
  • Beta-carotene oxygenase 1
  • Beta, beta-carotene 15, 15'-monooxygenase
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) in samples from tissue homogenates, cell lysates and other biological fluids with no significant corss-reactivity with analogues from other species.

Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) Polyclonal Antibody (Human)

  • EUR 247.00
  • EUR 2510.00
  • EUR 625.00
  • EUR 310.00
  • EUR 214.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
  • Sequence of the immunogen: bCMO1 (Gly6~Pro206)
  • Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Description: A Rabbit polyclonal antibody against Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1)

Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) Polyclonal Antibody (Human), APC

  • EUR 345.00
  • EUR 3275.00
  • EUR 912.00
  • EUR 440.00
  • EUR 219.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
  • Sequence of the immunogen: bCMO1 (Gly6~Pro206)
  • Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Description: A Rabbit polyclonal antibody against Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1). This antibody is labeled with APC.

Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) Polyclonal Antibody (Human), Biotinylated

  • EUR 311.00
  • EUR 2460.00
  • EUR 727.00
  • EUR 381.00
  • EUR 219.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
  • Sequence of the immunogen: bCMO1 (Gly6~Pro206)
  • Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Description: A Rabbit polyclonal antibody against Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1). This antibody is labeled with Biotin.

Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) Polyclonal Antibody (Human), Cy3

  • EUR 419.00
  • EUR 4325.00
  • EUR 1175.00
  • EUR 545.00
  • EUR 251.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
  • Sequence of the immunogen: bCMO1 (Gly6~Pro206)
  • Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Description: A Rabbit polyclonal antibody against Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1). This antibody is labeled with Cy3.

Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) Polyclonal Antibody (Human), FITC

  • EUR 296.00
  • EUR 2640.00
  • EUR 750.00
  • EUR 372.00
  • EUR 195.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
  • Sequence of the immunogen: bCMO1 (Gly6~Pro206)
  • Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Description: A Rabbit polyclonal antibody against Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1). This antibody is labeled with FITC.

Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) Polyclonal Antibody (Human), HRP

  • EUR 316.00
  • EUR 2855.00
  • EUR 807.00
  • EUR 398.00
  • EUR 206.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
  • Sequence of the immunogen: bCMO1 (Gly6~Pro206)
  • Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Description: A Rabbit polyclonal antibody against Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1). This antibody is labeled with HRP.

Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) Polyclonal Antibody (Human), PE

  • EUR 296.00
  • EUR 2640.00
  • EUR 750.00
  • EUR 372.00
  • EUR 195.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
  • Sequence of the immunogen: bCMO1 (Gly6~Pro206)
  • Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Description: A Rabbit polyclonal antibody against Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1). This antibody is labeled with PE.

Human Beta,beta-carotene 15,15'-dioxygenase (BCO1) ELISA Kit

abx392200-96tests 96 tests
EUR 911
  • Shipped within 5-12 working days.

Mouse Beta,beta-Carotene 15,15-Dioxygenase (BCO1) ELISA Kit

abx388677-96tests 96 tests
EUR 911
  • Shipped within 5-12 working days.

Rat Beta,beta-Carotene 15,15-Dioxygenase (BCO1) ELISA Kit

abx391017-96tests 96 tests
EUR 911
  • Shipped within 5-12 working days.

Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) Polyclonal Antibody (Human), APC-Cy7

  • EUR 571.00
  • EUR 6430.00
  • EUR 1705.00
  • EUR 760.00
  • EUR 319.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
  • Sequence of the immunogen: bCMO1 (Gly6~Pro206)
  • Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Description: A Rabbit polyclonal antibody against Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1). This antibody is labeled with APC-Cy7.

Beta,beta-Carotene 15,15'-Dioxygenase (BCO1) Antibody

  • EUR 411.00
  • EUR 1845.00
  • EUR 599.00
  • EUR 182.00
  • EUR 300.00
  • 100 ug
  • 1 mg
  • 200 ug
  • 20 ug
  • 50 ug
  • Shipped within 5-10 working days.

Beta,beta-Carotene 15,15'-Dioxygenase (BCO1) Antibody (HRP)

  • EUR 411.00
  • EUR 1845.00
  • EUR 599.00
  • EUR 182.00
  • EUR 300.00
  • 100 ug
  • 1 mg
  • 200 ug
  • 20 ug
  • 50 ug
  • Shipped within 5-10 working days.

Beta,beta-Carotene 15,15'-Dioxygenase (BCO1) Antibody (FITC)

  • EUR 411.00
  • EUR 1845.00
  • EUR 599.00
  • EUR 182.00
  • EUR 300.00
  • 100 ug
  • 1 mg
  • 200 ug
  • 20 ug
  • 50 ug
  • Shipped within 5-10 working days.

Beta,beta-Carotene 15,15'-Dioxygenase (BCO1) Antibody (Biotin)

  • EUR 411.00
  • EUR 1845.00
  • EUR 599.00
  • EUR 182.00
  • EUR 300.00
  • 100 ug
  • 1 mg
  • 200 ug
  • 20 ug
  • 50 ug
  • Shipped within 5-10 working days.

Human beta carotene

QY-E05643 96T
EUR 361


GP8334-10G 10 g
EUR 102


GP8334-1G 1 g
EUR 48


GP8334-25G 25 g
EUR 174


GP8334-5G 5 g
EUR 74


TB0299 8XX100mg
EUR 274

Custom Antibody titration by ELISA up to 2 rabbits and 1 bleed

EUR 202

Bcmo1/ Rat Bcmo1 ELISA Kit

ELI-33406r 96 Tests
EUR 886

Human BCO2/ Beta,beta-carotene 9',10'-oxygenase ELISA Kit

E0265Hu 1 Kit
EUR 605

ELISA kit for Human Beta,beta-carotene 9',10'-oxygenase

EK2713 96 tests
EUR 553
Description: Enzyme-linked immunosorbent assay kit for quantification of Human Beta,beta-carotene 9',10'-oxygenase in samples from serum, plasma, tissue homogenates and other biological fluids.

Human BCO2(Beta,beta-carotene 9',10'-oxygenase) ELISA Kit

EH1224 96T
EUR 567.6
  • Detection range: 0.78-50 ng/ml
  • Uniprot ID: Q9BYV7
  • Alias: BCO2/Beta,beta-carotene 9',10'-oxygenase/B-diox-II/Beta-carotene dioxygenase 2
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Homo sapiens;Sensitivity: 0.469 ng/ml

Human Beta,beta- carotene 9',10'- oxygenase, BCO2 ELISA KIT

ELI-49386h 96 Tests
EUR 824

Human Beta,beta-Carotene 9',10'-Oxygenase (BCO2) ELISA Kit

abx250481-96tests 96 tests
EUR 668
  • Shipped within 5-12 working days.

Mouse Beta,beta-Carotene 9',10'-Oxygenase (BCO2) ELISA Kit

abx515122-96tests 96 tests
EUR 739
  • Shipped within 5-12 working days.

Mouse Beta,beta- carotene 9',10'- oxygenase, Bco2 ELISA KIT

ELI-49387m 96 Tests
EUR 865

Mouse Bco2/ Beta,beta-carotene 9',10'-oxygenase ELISA Kit

E0170Mo 1 Kit
EUR 632

Human Interleukin-1 beta (IL-1 beta) AssayMax ELISA Kit

EI2200-1 96 Well Plate
EUR 477

BCMO1 ELISA Kit (Human) (OKCD04382)

OKCD04382 96 Wells
EUR 831
Description: Description of target: Vitamin A metabolism is important for vital processes such as vision, embryonic development, cell differentiation, and membrane and skin protection. The protein encoded by this gene is a key enzyme in beta-carotene metabolism to vitamin A. It catalyzes the oxidative cleavage of beta,beta-carotene into two retinal molecules.;Species reactivity: Human;Application: ;Assay info: Assay Methodology: Quantitative Sandwich ELISA;Sensitivity: 0.49 ng/mL

Human TGF-beta-1 AssayMax ELISA Kit

ET3102-1 96 Well Plate
EUR 477


ELI-25375c 96 Tests
EUR 928

Beta,beta-Carotene 9',10'-Oxygenase (BCO2) Antibody

abx122472-100ug 100 ug
EUR 391
  • Shipped within 5-10 working days.

Beta,beta-Carotene 9',10'-Oxygenase (BCO2) Antibody

  • EUR 411.00
  • EUR 592.00
  • EUR 182.00
  • EUR 314.00
  • 100 ul
  • 200 ul
  • 20 ul
  • 50 ul
  • Shipped within 5-10 working days.

Beta,beta-Carotene 9',10'-Oxygenase (BCO2) Antibody

abx230852-100ug 100 ug
EUR 481
  • Shipped within 5-12 working days.

Mouse Interleukin-1 beta (IL-1 beta) AssayMax ELISA Kit

EMI2200-1 96 Well Plate
EUR 477

YWHAB Tyr-3/Trp- 5 Monooxygenase Activation Protein Beta Human Recombinant Protein

PROTP31946-1 Regular: 25ug
EUR 317
Description: YWHAB Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 246 amino acids (1-246) and having a molecular mass of 28kDa. ;YWHAB is purified by proprietary chromatographic techniques.


HY-N0411 50mg
EUR 108


TBZ2607 5mg Ask for price

Human Methylsterol monooxygenase 1, MSMO1 ELISA KIT

ELI-23191h 96 Tests
EUR 824

Human Methylsterol monooxygenase 1 (MSMO1) ELISA Kit

abx385151-96tests 96 tests
EUR 911
  • Shipped within 5-12 working days.


  • EUR 551.00
  • EUR 732.00
  • 15 nmol
  • 30 nmol
  • Shipped within 5-10 working days.


  • EUR 551.00
  • EUR 732.00
  • 15 nmol
  • 30 nmol
  • Shipped within 5-10 working days.

Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit

  • EUR 7378.00
  • EUR 3933.00
  • EUR 911.00
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests
  • Shipped within 5-7 working days.

Human Monooxygenase DBH Like 1 (MOXD1) ELISA Kit

abx381498-96tests 96 tests
EUR 911
  • Shipped within 5-12 working days.

Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit

DLR-FMO1-Hu-48T 48T
EUR 517
  • Should the Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A sandwich quantitative ELISA assay kit for detection of Human Flavin Containing Monooxygenase 1 (FMO1) in samples from tissue homogenates or other biological fluids.

Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit

DLR-FMO1-Hu-96T 96T
EUR 673
  • Should the Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A sandwich quantitative ELISA assay kit for detection of Human Flavin Containing Monooxygenase 1 (FMO1) in samples from tissue homogenates or other biological fluids.

Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit

RD-FMO1-Hu-48Tests 48 Tests
EUR 521

Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit

RD-FMO1-Hu-96Tests 96 Tests
EUR 723

Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit

RDR-FMO1-Hu-48Tests 48 Tests
EUR 544

Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit

RDR-FMO1-Hu-96Tests 96 Tests
EUR 756

Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit

SEF458Hu-10x96wellstestplate 10x96-wells test plate
EUR 4731.5
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Flavin Containing Monooxygenase 1 (FMO1) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-As
  • Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Flavin Containing Monooxygenase 1 (FMO1) in Tissue homogenates and other biological fluids.

Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit

SEF458Hu-1x48wellstestplate 1x48-wells test plate
EUR 477.3
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Flavin Containing Monooxygenase 1 (FMO1) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-As
  • Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Flavin Containing Monooxygenase 1 (FMO1) in Tissue homogenates and other biological fluids.

Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit

SEF458Hu-1x96wellstestplate 1x96-wells test plate
EUR 639
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Flavin Containing Monooxygenase 1 (FMO1) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-As
  • Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Flavin Containing Monooxygenase 1 (FMO1) in Tissue homogenates and other biological fluids.

Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit

SEF458Hu-5x96wellstestplate 5x96-wells test plate
EUR 2575.5
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Flavin Containing Monooxygenase 1 (FMO1) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-As
  • Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Flavin Containing Monooxygenase 1 (FMO1) in Tissue homogenates and other biological fluids.

Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit

  • EUR 4782.00
  • EUR 2526.00
  • EUR 640.00
  • 10 plates of 96 wells
  • 5 plates of 96 wells
  • 1 plate of 96 wells
  • Known also as Flavin Containing Monooxygenase 1 elisa. Alternative names of the recognized antigen: Dimethylaniline oxidase 1
  • Fetal hepatic flavin-containing monooxygenase 1
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Flavin Containing Monooxygenase 1 (FMO1) in samples from Tissue homogenates and other biological fluids. with no significant corss-reactivity with analogues from other species.

ExoAb Antibody Kit (CD9, CD63, CD81, Hsp70 antibodies, rabbit anti-human) with goat anti-rabbit HRP secondary antibody

EXOAB-KIT-1 25 ul each
EUR 627
  • Category: Exosomes

mRNAExpress mRNA Synthesis kit (5 reactions)

MR-KIT-1 5 reactions
EUR 1152
  • Category: Stem Cell Products

Human Alkylglycerol monooxygenase(TMEM195) ELISA kit

E01A2009-192T 192 tests
EUR 1270
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A sandwich ELISA for quantitative measurement of Human Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Human Alkylglycerol monooxygenase(TMEM195) ELISA kit

E01A2009-48 1 plate of 48 wells
EUR 520
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A sandwich ELISA for quantitative measurement of Human Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Human Alkylglycerol monooxygenase(TMEM195) ELISA kit

E01A2009-96 1 plate of 96 wells
EUR 685
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A sandwich ELISA for quantitative measurement of Human Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Human SQLE/ Squalene monooxygenase ELISA Kit

E2385Hu 1 Kit
EUR 605

Human Alkylglycerol monooxygenase, AGMO ELISA KIT

ELI-24195h 96 Tests
EUR 824

Kynurenine 3-monooxygenase ELISA Kit|Human

EF005180 96 Tests
EUR 689

Human Squalene monooxygenase, SQLE ELISA KIT

ELI-32784h 96 Tests
EUR 824

Human Alkylglycerol Monooxygenase (AGMO)ELISA Kit

201-12-2419 96 tests
EUR 440
  • This Alkylglycerol Monooxygenase ELISA kit is validated to work with samples from whole blood, serum, plasma and cell culture supernatant.
Description: A quantitative ELISA kit for measuring Human in samples from biological fluids.

Human Alkylglycerol Monooxygenase(AGMO)ELISA Kit

QY-E01119 96T
EUR 361

PinPoint-FC 293T Platform Kit for Targeted Gene Insertion (includes PIN320A-1, PIN200A-1, PIN510A-1 & PIN600A-1)

PIN320A-KIT 1 Kit
EUR 4941
  • Category: PinPoint Integrase Tools

Human BCMO1 shRNA Plasmid

  • EUR 801.00
  • EUR 1121.00
  • 150 µg
  • 300 µg
  • Shipped within 15-20 working days.

BCMO1 Recombinant Protein (Human)

RP036973 100 ug Ask for price

BCMO1 Recombinant Protein (Human)

RP036976 100 ug Ask for price

Chicken Methylsterol monooxygenase 1, MSMO1 ELISA KIT

ELI-23404c 96 Tests
EUR 928

Mouse Methylsterol monooxygenase 1, Msmo1 ELISA KIT

ELI-45646m 96 Tests
EUR 865

Porcine Methylsterol monooxygenase 1, MSMO1 ELISA KIT

ELI-42078p 96 Tests
EUR 928

Mouse Methylsterol monooxygenase 1 (MSMO1) ELISA Kit

abx389876-96tests 96 tests
EUR 911
  • Shipped within 5-12 working days.

Rat Methylsterol monooxygenase 1 (MSMO1) ELISA Kit

abx391608-96tests 96 tests
EUR 911
  • Shipped within 5-12 working days.

PinPoint-FC Murine iPSC Platform Kit for Targeted Gene Insertion (includes PIN340iPS-1, PIN200A-1, PIN510A-1 & PIN600A-1)

PIN340iPS-KIT 1 Kit
EUR 4941
  • Category: PinPoint Integrase Tools

Human Beta-2-Microglobulin (B2M) AssayMax ELISA Kit

EM5001-1 96 Well Plate
EUR 417

Tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein Beta (YWHAB) Antibody

  • EUR 314.00
  • EUR 244.00
  • 100 ug
  • 50 ug
  • Shipped within 5-10 working days.

Tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein Beta (YWHAB) Antibody

  • EUR 411.00
  • EUR 300.00
  • 100 ul
  • 50 ul
  • Shipped within 5-10 working days.

Tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein Beta (YWHAB) Antibody

  • EUR 411.00
  • EUR 300.00
  • 100 ul
  • 50 ul
  • Shipped within 5-10 working days.

Tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein Beta (YWHAB) Antibody

abx332554-100ul 100 ul
EUR 425
  • Shipped within 5-10 working days.

Tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein Beta (YWHAB) Antibody

  • EUR 411.00
  • EUR 300.00
  • 100 ul
  • 50 ul
  • Shipped within 5-10 working days.

Tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein Beta (YWHAB) Antibody

  • EUR 411.00
  • EUR 300.00
  • 100 ul
  • 50 ul
  • Shipped within 5-10 working days.

Msmo1 ELISA Kit| Rat Methylsterol monooxygenase 1 ELISA Kit

EF018966 96 Tests
EUR 689

Msmo1 ELISA Kit| Mouse Methylsterol monooxygenase 1 ELISA Kit

EF015513 96 Tests
EUR 689

MSMO1 ELISA Kit| chicken Methylsterol monooxygenase 1 ELISA Kit

EF012392 96 Tests
EUR 689

Amyloid Beta-Peptide (1-40) (human)

A1124-1 1 mg
EUR 189
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein.

Recombinant Human Heregulin Beta -1 Protein

PROTQ02297-1 50ug
EUR 317
Description: Neuregulin/Heregulin is a family of structurally related polypeptide growth factors derived from alternatively spliced genes (NRG1, NRG2, NRG3 and NRG4). To date, there are over 14 soluble and transmembrane proteins derived from the NRG1 gene. Proteolytic processing of the extracellular domain of the transmembrane NRG1 isoforms release soluble growth factors. HRG1-β1 contains an Ig domain and an EGF-like domain that is necessary for direct binding to receptor tyrosine kinases erb3 and erb4. This binding induces erb3 and erb4 heterodimerization with erb2, stimulating intrinsic kinase activity, which leads to tyrosine phosphorylation. Although HRG1-β1 biological effects is still unclear, it has been found to promote motility and invasiveness of breast cancer cells which may also involve up-regulation of expression and function of the autocrine motility-promoting factor (AMF). Recombinant human Heregulin-β1 (HRG1-β1) is a 7.5 kDa polypeptide consisting of only the EGF domain of Heregulin-β1 (65 amino acid residues).

ELISA kit for Human FMO1 (Flavin Containing Monooxygenase 1)

ELK4594 1 plate of 96 wells
EUR 432
  • The microtiter plate provided in this kit has been pre-coated with an antibody specific to Flavin Containing Monooxygenase 1 (FMO1). Standards or samples are then added to the appropriate microtiter plate wells with a biotin-conjugated antibody speci
  • Show more
Description: A sandwich ELISA kit for detection of Flavin Containing Monooxygenase 1 from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids.

Human DBH- like monooxygenase protein 1, MOXD1 ELISA KIT

ELI-43781h 96 Tests
EUR 824

BCMO1 sgRNA CRISPR Lentivector (Human) (Target 1)

K0177302 1.0 ug DNA
EUR 154

Human bCMO1(Beta-Carotene-15,15′-Monooxygenase 1) ELISA Kit